BioClaw Setup: Chat Your Way to BLAST

Mar 19, 2026

Key Takeaways

  • BioClaw is a bioinformatics AI agent built on OpenClaw — run BLAST, build phylogenetic trees, and analyze sequences from any messaging app
  • 17 bioinformatics skills pre-installed: BLAST, multiple sequence alignment, phylogenetics, primer design, ORF finding, and more
  • Works on WhatsApp, Telegram, Discord, Slack, Feishu — any platform OpenClaw supports
  • Docker deployment recommended — includes all bioinformatics tools pre-configured
  • Developed by Runchuan-BU, open-source under MIT license

What Is BioClaw?

BioClaw is a bioinformatics AI agent built on OpenClaw. Instead of opening a terminal and typing BLAST commands, you drop a protein sequence into your group chat and get results back — with publication-ready formatting.

Core attributes:

  • Category: Bioinformatics AI agent
  • Base framework: OpenClaw (TypeScript)
  • Repository: Runchuan-BU/BioClaw
  • Skills: 17 bioinformatics skills pre-installed
  • Deployment: Docker recommended
  • License: MIT

17 Bioinformatics Skills

SkillWhat It Does
BLASTSequence similarity search against NCBI databases
Multiple Sequence AlignmentAlign multiple sequences using MUSCLE/ClustalW
Phylogenetic TreesBuild and visualize evolutionary trees
Primer DesignDesign PCR primers with Tm and GC% optimization
ORF FindingIdentify open reading frames in nucleotide sequences
Protein StructurePredict and visualize 3D protein structures
Gene AnnotationAnnotate genomic features
Sequence Format ConversionConvert between FASTA, GenBank, EMBL formats
Restriction AnalysisFind restriction enzyme cut sites
Codon OptimizationOptimize codon usage for expression systems

Plus 7 additional specialized skills for genomics and molecular biology workflows.


Quick Start with Docker

Pull and Run

docker pull bioclaw/bioclaw:latest
docker run -d -p 3000:3000 \
  -e OPENAI_API_KEY=sk-xxx \
  -e ANTHROPIC_API_KEY=sk-ant-xxx \
  bioclaw/bioclaw:latest

Connect Your Messaging App

# Telegram
docker run -d -e TELEGRAM_BOT_TOKEN=xxx bioclaw/bioclaw:latest

# WhatsApp (via WhatsApp Web bridge)
docker run -d -e WHATSAPP_ENABLED=true bioclaw/bioclaw:latest

Test with a BLAST Query

Send this message in your connected app:

BLAST this sequence against nr database:
MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKS

BioClaw will run BLAST, format the results, and send them back with top hits, E-values, and alignment summaries.


Who Should Use BioClaw?

User TypeUse Case
Wet lab biologistsQuick sequence checks without opening a terminal
Research groupsShared bioinformatics assistant in the lab group chat
TeachingStudents can run bioinformatics queries from their phones
Field researchersAccess bioinformatics tools from mobile devices

BioClaw vs ClawBio

These two projects share similar names but have different philosophies:

AspectBioClawClawBio
PhilosophyAccessibility — run bioinfo from any chat appSecurity — audit every analysis step
InterfaceMulti-platform messaging (WhatsApp, Discord, etc.)CLI/API, no messaging integration
WorkflowsAI-generated on the flyPre-approved by domain experts
ReproducibilityStandard outputCryptographic reproducibility bundles
Best forQuick analyses, teaching, accessibilityClinical research, audited environments

See our ClawBio vs BioClaw comparison for a full deep dive.


FAQ

Q1: Do I need bioinformatics tools installed locally?

With Docker, no — everything is pre-configured. Without Docker, you'll need BLAST+, MUSCLE, and other tools installed on your system.

Q2: Can I add custom bioinformatics skills?

Yes. BioClaw uses the standard OpenClaw skill format. Create a SKILL.md file for your tool and add it to the skills directory.

Q3: Is it suitable for analyzing sensitive patient data?

BioClaw sends data to cloud LLM providers by default. For sensitive data, use a local LLM backend (Ollama) or consider ClawBio which keeps all data local.

Q4: What LLM providers are supported?

Any provider supported by OpenClaw — OpenAI, Anthropic, Google, Ollama, and more.

Q5: Can multiple people use the same BioClaw instance?

Yes. When deployed in a group chat, all members can interact with the same BioClaw instance. Useful for research lab group chats.


Summary

BioClaw is the fastest way to get bioinformatics AI assistance — install via Docker, connect your messaging app, and start running BLAST queries from your phone. With 17 pre-installed skills covering the core bioinformatics toolkit, it turns any group chat into a shared bioinformatics workstation. Best for accessibility and teaching; consider ClawBio for audit-sensitive environments.